PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA37646
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NAC
Protein Properties Length: 408aa    MW: 47305.9 Da    PI: 4.6933
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA37646genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1652.6e-51201462128
                        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                                +pGfrFhPtdeelv++yLk+k+ gk l++ +vi e+d+yk++P+dLp +  +k+++++w+fF++rd+ky++g r nrat++gyW
  Tp57577_TGAC_v2_mRNA37646  20 MPGFRFHPTDEELVMYYLKRKICGKMLKF-NVICETDVYKWDPEDLPyQsFLKTGDRQWFFFCHRDRKYPNGGRCNRATTHGYW 102
                                69*************************99.99**************96346788999*************************** PP

                        NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                k+tgkd++v+  +++lvg+kktLvfy grap+ge+tdWvmhey++
  Tp57577_TGAC_v2_mRNA37646 103 KTTGKDRNVMF-NSRLVGVKKTLVFYLGRAPNGERTDWVMHEYTM 146
                                ***********.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-5716169IPR003441NAC domain
PROSITE profilePS5100552.05919169IPR003441NAC domain
PfamPF023656.3E-2721145IPR003441NAC domain
PfamPF142447.8E-15300346IPR029472Gag-polypeptide of LTR copia-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGWVSESASA DAFSEVISSM PGFRFHPTDE ELVMYYLKRK ICGKMLKFNV ICETDVYKWD  60
PEDLPYQSFL KTGDRQWFFF CHRDRKYPNG GRCNRATTHG YWKTTGKDRN VMFNSRLVGV  120
KKTLVFYLGR APNGERTDWV MHEYTMDEEE LKRCHDVKEC YALYKLFKKS GPGPKNGEQY  180
GAPFKEEDWL DDNVVDFNVK SAQLEAPKDD VLNPFTDQPQ QLAVVNAFTD QQQPLFGDDI  240
DEFFNRAFDV APVLDQQYIT DQQQPLFGDD IDEFFNGAFD PLAPQNKGYQ NDTLNPYFLH  300
PNENPGNILV SPLLSGSNYH SWSRAMTVAF RSKHKLHFIT GSLPRPSDDD HDYIAWDRCN  360
TMIMSWISNA VEPEISQSIL WMDTASEIWQ DLNERFYQGD IFRISDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-452114617140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004496404.11e-141PREDICTED: NAC domain-containing protein 16-like
TrEMBLA0A072VNK61e-138A0A072VNK6_MEDTR; NAC transcription factor-like protein
STRINGGLYMA10G36360.11e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61313451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.12e-95NAC domain containing protein 17